peptide purity raises a handful of sensible questions. This page answers them in order, starting with the fundamentals and moving to applications.
This page was last updated on 2025-09-08 and is reviewed periodically as new material appears.
Lyophilized selank is normally supplied as a dry powder and is considered stable for extended periods when kept cold and dry. Moisture uptake is the main practical threat, because absorbed water promotes both hydrolysis and aggregation in the solid state. Vials are usually warmed to room temperature before opening so that condensation does not form on the powder. Supplier documentation commonly specifies -20 °C for routine storage, with -80 °C used for material intended to be archived for years.
Once dissolved, the peptide is markedly less stable than the dry powder. Aqueous solutions are subject to backbone hydrolysis and to microbial growth when they are handled without sterile technique. Buffered solutions near neutral pH are common for short-term laboratory work, while acidic conditions are sometimes used to improve solubility. Analytical laboratories generally prepare working solutions fresh rather than storing them, and a residual water film left in a reopened vial can seed degradation even when the container appears dry.
Reversed-phase high-performance liquid chromatography is the standard technique for estimating peptide purity. The result is a peak-area percentage, which describes how much of the detected material elutes as the main peak in one run. Mass spectrometry confirms the molecular mass and can reveal truncated, adducted, or otherwise modified species. Amino acid analysis or tandem mass spectrometry can address sequence fidelity when identity is in doubt. None of these measurements, taken alone, establishes that a sample is fit for any specific purpose.
Peptide bonds in selank are susceptible to hydrolysis under strongly acidic or basic conditions, and the terminal proline residues are vulnerable to exopeptidase activity in biological samples. Lyophilized powder stored dry at -20 °C typically remains stable for extended periods, whereas aqueous solutions degrade faster and may lose measurable purity within days to weeks depending on pH, temperature, and microbial load. Repeated freeze-thaw cycles promote aggregation and adsorption to container surfaces. For analytical work, solutions are usually prepared fresh, kept cold, and used within a single working day.
Handling follows standard practice for research peptides. Material is weighed in a low-humidity environment because the powder absorbs atmospheric moisture. Purity is reported as the percentage area of the main peak in a chromatogram, with specifications commonly set at 95 percent or higher; values below that threshold indicate the presence of truncated or modified species. Residual trifluoroacetate from purification is often present and may affect mass balance. Certificates of analysis should state the analytical method, the column and gradient used, and the lot-specific retention time so that results can be compared across suppliers.
| Property | Value | Notes |
|---|---|---|
| Typical purity specification | 95 percent or higher by RP-HPLC | Area percentage of the main peak |
| Identity confirmation | Electrospray ionization mass spectrometry | Observed mass compared with the theoretical value near 751.9 Da |
| Recommended dry storage | -20 °C, desiccated | -80 °C for multi-year archival material |
| Solution handling | Prepare fresh; avoid long storage | Sterile filtration reduces microbial load |
| Common synonyms | TKPRPGP; TP-7 | Sequence code and laboratory designation used interchangeably |
Enzymatic stability motivates the extra three residues at the carboxyl end. Native tuftsin is cleaved quickly by circulating aminopeptidases and carboxypeptidases, which limits its duration of action and its usefulness as a tool compound. Extending the chain with proline-rich segments is a common design tactic because proline constrains the backbone and slows proteolysis. The same Pro-Gly-Pro motif appears in other Russian-developed peptides of the era. Whether the full seven-residue chain is required for activity, or whether it acts mainly as a prodrug releasing tuftsin, remains unresolved.
Selank is a synthetic heptapeptide with the sequence Thr-Lys-Pro-Arg-Pro-Gly-Pro. Its four N-terminal residues reproduce tuftsin, a tetrapeptide fragment of the immunoglobulin heavy chain, while the C-terminal Pro-Gly-Pro extension is a synthetic addition. The peptide has a molecular mass near 752 daltons and carries a net positive charge at physiological pH because of the arginine and lysine side chains. Published indexes list it under the name Selank and the sequence abbreviation TKPRPGP. Solid-phase peptide synthesis is the standard production route for research quantities.
Development took place at the Institute of Molecular Genetics of the Russian Academy of Sciences, where a series of short peptides were designed in the 1980s and 1990s. Selank was selected from variants of tuftsin that showed resistance to plasma peptidases. Russian regulatory approval covers it as an anxiolytic agent given intranasally. Outside that market the compound is normally handled as a research chemical rather than a medicine, and no widely recognised international pharmacopoeial monograph exists. The name Selank is a coined trade designation rather than a systematic chemical name.
Lyophilized material is generally stable for extended periods when kept dry at or below minus twenty degrees Celsius. Working solutions are less stable, and common practice is to aliquot and freeze them so that repeated freeze-thaw cycles are avoided. Aqueous solutions are sensitive to pH extremes and to microbial growth, so short-term storage at refrigerator temperature is typical. Oxidation and hydrolysis are the principal degradation routes. Reconstitution with sterile water or a mild buffer is standard, and solutions should be protected from light.
Regulatory treatment varies by jurisdiction. In Russia the compound is a registered prescription product, while in the European Union and the United States it is generally handled as a research chemical without a marketing authorization. Suppliers therefore operate outside pharmaceutical oversight, and buyers rely on supplier documentation for purity and identity claims. Chain of custody and third-party testing are the main verification tools. Analysts note that the absence of a pharmacopoeial monograph for research-grade material limits standardization across vendors.
Reverse-phase high-performance liquid chromatography with ultraviolet detection near 214 nanometres is the standard purity method. Mass spectrometry, typically electrospray ionisation, confirms identity through the expected mass-to-charge pattern. Amino acid analysis can verify composition independently. Chiral purity requires separate techniques such as derivatisation followed by chromatographic separation, and such data are rarely reported for research-grade material.
Quantification in biological matrices relies on liquid chromatography coupled to tandem mass spectrometry with stable-isotope internal standards. Low plasma concentrations and adsorption to container surfaces both complicate measurement. Solid-phase extraction is often needed to reduce matrix interference before injection. Reported limits of quantification differ widely between laboratories, which makes direct comparison of pharmacokinetic results difficult and limits meta-analysis.
On April 4, 2011, Texas Instruments announced that it had agreed to buy National Semiconductor for $6.5 billion in cash. Texas Instruments paid $25 per share of National Semiconductor stock, an 80% premium over the April 4, 2011, closing share price of $14.07. The deal made Texas Instruments one of the world's largest makers of analog technology components. On September 19, 2011, the Chinese minister approved the merger, the last one needed. The companies formally merged on September 23, 2011.
==== Single atom ==== In 2008, a one atom thick, 10 atoms wide transistor was made of graphene. In 2022, researchers built a 0.34 nanometer (on state) single atom graphene transistor, smaller than a related device that used carbon nanotubes instead of graphene. The graphene formed the gate. Silicon dioxide was used as the base. The graphene sheet was formed via chemical vapor deposition, laid on top of the SiO2. A sheet of aluminum oxide was laid atop the graphene. The Al2Ox and SiO2 sandwiching the graphene act as insulators. They then etched into the sandwiched materials, cutting away the graphene and Al2Ox to create a step that exposed the edge of the graphene. They then added layers of hafnium oxide and molybdenum disulfide (another 2D material) to the top, side, and bottom of the step. Electrodes were then added to the top and bottom as source and drain. They call this construction a "sidewall transistor". The on/off ratio reached 1.02×105 and subthreshold swing values were 117 mV dec–1.
==== Essays on fascism ==== Starting with his 1947 essay Wagner, Nietzsche and Hitler, Adorno produced a series of influential works to describe psychological fascist traits. One of these works was The Authoritarian Personality (1950), published as a contribution to the Studies in Prejudice performed by multiple research institutes in the US, and consisting of 'qualitative interpretations' that uncovered the authoritarian character of test persons through indirect questions. The books have had a major influence on sociology and remain highly discussed and debated. In 1951 he continued on the topic with his essay Freudian Theory and the Pattern of Fascist Propaganda, in which he said that "Psychological dispositions do not actually cause fascism; rather, fascism defines a psychological area which can be successfully exploited by the forces which promote it for entirely non-psychological reasons of self-interest." In 1952 Adorno participated in a group experiment, revealing residual National Socialist attitudes among the recently democratized Germans. He then published two influential essays, The Meaning of Working Through the Past (1959) and Education after Auschwitz (1966), in which he argued on the survival of the uneradicated National Socialism in the mindsets and institutions of the post-1945 Germany and that there is still a real risk that it could rise again.
Glutathione disulfide (GSSG) is a disulfide derived from two glutathione molecules. In living cells, glutathione disulfide is reduced into two molecules of glutathione with reducing equivalents from the coenzyme NADPH. This reaction is catalyzed by the enzyme glutathione reductase. Antioxidant enzymes, such as glutathione peroxidases and peroxiredoxins, generate glutathione disulfide during the reduction of peroxides such as hydrogen peroxide (H2O2) and organic hydroperoxides (ROOH):
Sources: en.wikipedia.org
A review of different cell geometries with their specific electric configurations is available in the literature. However, ICR cells can belong to one of the following two categories: closed cells or open cells. Several closed ICR cells with different geometries were fabricated and their performance has been characterized. Grids were used as end caps to apply an axial electric field for trapping ions axially (parallel to the magnetic field lines). Ions can be either generated inside the cell or can be injected to the cell from an external ionization source. Nested ICR cells with double pair of grids were also fabricated to trap both positive and negative ions simultaneously. The most common open cell geometry is a cylinder, which is axially segmented to produce electrodes in the shape of a ring. The central ring electrode is commonly used for applying radial excitation electric field and detection. DC electric voltage is applied on the terminal ring electrodes to trap ions along the magnetic field lines. Open cylindrical cells with ring electrodes of different diameters have also been designed. They proved not only capable in trapping and detecting both ion polarities simultaneously, but also they succeeded to separate positive from negative ions radially. This presented a large discrimination in kinetic ion acceleration between positive and negative ions trapped simultaneously inside the new cell. Several ion axial acceleration schemes were recently written for ion–ion collision studies.
== Joint ventures == Transystem TLI is a joint venture between TCI and Mitsui & Co Ltd, which is a logistics partner for Toyota Kirloskar Motors Ltd. in India. TCI-CONCOR Multimodal Solutions Private Limited is a joint venture with Container Corporation of India (CONCOR) for bulk transport by rail and road. In November 2021, TCI Cold Chain Solutions, a unit of Transport Corporation of India, formed a joint venture with Mitsui & Co. to expand temperature controlled logistics services in India. In February 2026, TCI signed a MOU with Flying Whales and its subsidiary Flying Whales Services to explore the use of heavy lift airships for logistics operations in India. The agreement included an assessment of the LCA60T, a rigid cargo airship with a proposed payload capacity of up to 60 tonnes and the ability to load and unload cargo while stationary in flight. The companies identified potential applications in sectors including defence, energy, infrastructure, construction, disaster relief and healthcare, particularly for transporting oversized cargo to remote or high altitude locations.
According to the Oxford English Dictionary, the English proper noun "India" derives most immediately from the Classical Latin India, a reference to a loosely-defined historical region of Asia stretching from South Asia to the borders of China. Further etymons are: Hellenistic Greek India (Ἰνδία); Ancient Greek Indos (Ἰνδός), or the River Indus; Achaemenian Old Persian Hinduš (an eastern province of the Achaemenid Empire); and Sanskrit Sindhu, or "river," but specifically the Indus river, and by extension its well-settled basin. The Ancient Greeks referred to South Asians as Indoi, 'the people of the Indus'. The term Bharat (Bhārat; pronounced [ˈbʱaːɾət] ), mentioned in both Indian epic poetry and the Constitution of India, is used in its variations by many Indian languages. A modern rendering of the historical name Bharatavarsha, which applied originally to North India, Bharat gained increased currency from the mid-19th century as a native name for India. Hindustan ([ɦɪndʊˈstaːn] ) is a Middle Persian name for India that became popular by the 13th century, and was used widely since the era of the Mughal Empire. The meaning of Hindustan has varied, referring to a region encompassing the northern Indian subcontinent (present-day northern India and Pakistan) or to India in its near entirety.
== Taxonomy and phylogeny == Pholcus phalangioides was first described in 1775 by the Swiss entomologist Johann Kaspar Füssli. A member of the genus Pholcus in the family Pholcidae, P. phalangioides shares ancestry with roughly 1,340 similar cellar-spiders. All of these spiders are known for their characteristic long legs, which can range from 5 to 6 times the size of their bodies. This is not to be confused with organisms with similar physical appearances, such as the crane fly – an insect – and harvestmen of the arachnid order Opiliones.
NADPH oxidase (nicotinamide adenine dinucleotide phosphate oxidase) is a membrane-bound enzyme complex that faces the extracellular space. It can be found in the plasma membrane as well as in the membranes of phagosomes used by neutrophil white blood cells to engulf microorganisms. Human isoforms of the catalytic component of the complex include NOX1, NOX2, NOX3, NOX4, NOX5, DUOX1, and DUOX2.
Sources: en.wikipedia.org
ALFA-tag, a de novo designed helical peptide tag (SRLEEELRRRLTE) for biochemical and microscopy applications. The tag is recognized by a repertoire of single-domain antibodies AviTag, a peptide allowing biotinylation by the enzyme BirA and so the protein can be isolated by streptavidin (GLNDIFEAQKIEWHE) EPEA-tag, commercially called CaptureSelect C-tag, a 4 AA peptide that is recognized by a VHH or single-domain camelid antibody which was discovered through phage display (EPEA) Calmodulin-tag, a peptide bound by the protein calmodulin (KRRWKKNFIAVSAANRFKKISSSGAL) iCapTag™ (intein Capture Tag), a self-removing peptide-based tag (MIKIATRKYLGKQNVYGIGVERDHNFALKNGFIAHN). The iCapTag™ is controlled by pH change. Typically the pH change occurs from pH 8.5 to pH 6.2 and causes release of tagless target-protein to eluent. If needed the pH shift and buffers can be optimized for protein-specific purification method (e.g., for membrane proteins detergent could be added to the buffers to increase solubility of the protein). In contrast to other protein purification methods, this method is not relaying on proteases to cleave off a tag from tag-protein complex. Instead, during elution phase since buffer pH is changed from 8.5 to pH 6.2 that triggers cleavage reaction resulting in a release of tagless target protein while highly engineered tag stays attached to the column. The expected purity of tagless target proteins or peptides is between 95-99%. The iCapTag™ contains patented component derived from Nostoc punctiforme (Npu) intein.
It would therefore appear desirable to process a material in such a way that it is physically uniform with regard to the distribution of components and porosity, rather than using particle size distributions which will maximize the green density. The containment of a uniformly dispersed assembly of strongly interacting particles in suspension requires total control over particle-particle interactions. A number of dispersants such as ammonium citrate (aqueous) and imidazoline or oleyl alcohol (nonaqueous) are promising solutions as possible additives for enhanced dispersion and deagglomeration. Monodisperse nanoparticles and colloids provide this potential. Monodisperse powders of colloidal silica, for example, may therefore be stabilized sufficiently to ensure a high degree of order in the colloidal crystal or polycrystalline colloidal solid which results from aggregation. The degree of order appears to be limited by the time and space allowed for longer-range correlations to be established. Such defective polycrystalline colloidal structures would appear to be the basic elements of sub-micrometer colloidal materials science, and, therefore, provide the first step in developing a more rigorous understanding of the mechanisms involved in microstructural evolution in high performance materials and components.
=== Derivatives === RGPU-95 (4-chlorophenylpiracetam) is a derivative of phenylpiracetam described as having 5- to 10-fold greater potency. Cebaracetam (CGS-25248; ZY-15119) is a derivative of RGPU-95 in which the terminal amide has been replaced with a 2-piperazinone moiety. Methylphenylpiracetam, including all four of its stereoisomers (especially the (4R,5S)-enantiomer E1R), is a positive allosteric modulator of the sigma σ1 receptor. It is currently the only known racetam demonstrating σ1 receptor modulation. Whereas phenylpiracetam stimulates locomotor activity in animals, the E1R enantiomer of methylphenylpiracetam does not do so at doses of up to 200 mg/kg. Phenylpiracetam hydrazide is a hydrazide derivative of phenylpiracetam described as having anticonvulsant effects. Other derivatives of phenylpiracetam have also been developed and studied.
Hypermobility, also known as double-jointedness, describes joints that stretch farther than normal. For example, some hypermobile people can bend their thumbs backwards to their wrists, bend their knee joints backwards, put their leg behind the head, or perform other contortionist "tricks". It can affect one or more joints throughout the body. Hypermobile joints are common and occur in about 10 to 25% of the population. Most have no other issues. In a minority of people, pain and other symptoms are present. In some cases, hypermobile joints are a feature of connective tissue disorders. One of these, Ehlers-Danlos Syndrome, was classified into several types which have been found to be genetic. Hypermobile Ehlers–Danlos syndrome (hEDS), formerly called EDS Type 3, remains the only EDS variant without a diagnostic DNA test. In 2016 the diagnostic criteria for hEDS were re-written to be more restrictive, with the intent of narrowing the pool of hEDS patients, in the hope of making it easier to identify a common genetic mutation and create a diagnostic DNA test. At the same time, joint hypermobility syndrome was renamed as hypermobility spectrum disorder, and redefined as a hypermobility disorder that does not meet the diagnostic criteria for any heritable Connective Tissue Disorder (such as hEDS, other types of Ehlers–Danlos Syndrome, Marfan Syndrome, Loeys–Dietz Syndrome, or osteogenesis imperfecta).
Sources: en.wikipedia.org
Sealed, desiccated storage at -20 °C or colder is the standard recommendation for research-grade material. Vials should reach room temperature before they are opened, which limits condensation. Repeated temperature cycling is discouraged.
A reported purity value reflects the share of the main peak in one chromatographic run and says nothing about identity. Confirming that the expected sequence is present requires a separate measurement such as mass spectrometry. Purity and identity are distinct questions.
A mass spectrum reports the molecular masses present in a sample and shows whether they match the value expected for selank, near 751.9 Da. It also flags common artifacts such as truncation or adduct formation. It does not establish correct stereochemistry or complete sequence order on its own.
Identity is confirmed by matching the retention time in reversed-phase chromatography against a reference standard and by measuring the molecular mass with mass spectrometry. Tandem mass spectrometry or amino acid analysis can verify the sequence of the seven residues. Because the peptide contains no aromatic amino acids, detection at 280 nm is not useful.